PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539691.1_FGP002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 524aa    MW: 58120.6 Da    PI: 6.1041
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539691.1_FGP002genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS431.95e-1321545231373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++++++c +av+++d +l++ l+++l +++s +gdp+qRl ay++e+L arl++s+s++yk+l+++e +   sse +++++l++e++P++k
  KN539691.1_FGP002 154 LKQVIIACGKAVAENDVRLTELLISELGQMVSVSGDPLQRLGAYMLEGLVARLSSSGSKIYKSLKCKEPT---SSELMSYMHLLYEICPFFK 242
                        57899****************************************************************9...9****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        f+++ aN aI ea++ge+ vHiiDf+i qG QW++L+qaLa+Rp+gpp lRiTg+++++s   +   l  +g rL k+A+++g+pfefn+ v
  KN539691.1_FGP002 243 FGYMSANGAIAEAIKGENFVHIIDFQIAQGSQWMTLIQALAARPGGPPFLRITGIDDSNSAyaRGGGLDIVGTRLYKVAQSFGLPFEFNA-V 333
                        *********************************************************988899999************************.7 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                          + +++ le+L+++ gE+++Vn+++qlh+++desvs+e++rd++L++vkslsP++v++veqe+++n+ +F+ r le+l+yy+a+f+s+++ 
  KN539691.1_FGP002 334 PAASHEVYLEHLDIRVGEVIVVNFAYQLHHTPDESVSTENHRDRILRMVKSLSPRLVTLVEQESNTNTRPFFPRYLETLDYYTAMFESIDVA 425
                        9999**************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        lpr+++ r++ E+++++r+ivn++acegaer+erhe ++kW++rl++aGF+p+pls+ +++++k+ll++++s  y +ee++g l+lgWk+r 
  KN539691.1_FGP002 426 LPRDDKRRMSAEQHCVARDIVNLIACEGAERVERHEVFGKWKARLTMAGFRPYPLSSVVNSTIKTLLHTYNSF-YWLEERDGVLYLGWKNRV 516
                        ***********************************************************************65.****************** PP

               GRAS 367 LvsvSaW 373
                        Lv+ SaW
  KN539691.1_FGP002 517 LVVSSAW 523
                        ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.571128505IPR005202Transcription factor GRAS
PfamPF035141.7E-129154523IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MPYYNNSVPS GGNGRFYITQ NHQDAHYASS DDGSQKIGSS PQAFEAPYCT LESSSANGAH  60
PAHSSVSSHS ISPISGSPLS HHDSHSDHTY NSPPSASCVT EITDLQIKLR ELENAILGPE  120
LDIAYDSPES ALQPNIMATP ENWRQLLGIN TGDLKQVIIA CGKAVAENDV RLTELLISEL  180
GQMVSVSGDP LQRLGAYMLE GLVARLSSSG SKIYKSLKCK EPTSSELMSY MHLLYEICPF  240
FKFGYMSANG AIAEAIKGEN FVHIIDFQIA QGSQWMTLIQ ALAARPGGPP FLRITGIDDS  300
NSAYARGGGL DIVGTRLYKV AQSFGLPFEF NAVPAASHEV YLEHLDIRVG EVIVVNFAYQ  360
LHHTPDESVS TENHRDRILR MVKSLSPRLV TLVEQESNTN TRPFFPRYLE TLDYYTAMFE  420
SIDVALPRDD KRRMSAEQHC VARDIVNLIA CEGAERVERH EVFGKWKARL TMAGFRPYPL  480
SSVVNSTIKT LLHTYNSFYW LEERDGVLYL GWKNRVLVVS SAWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-581565236374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1133350.0AC113335.1 Genomic sequence for Oryza sativa (japonica cultivar-group) cultivar Nipponbare clone OJ1003C07, from chromosome 10, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614551.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015614552.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLA0A0D3HCW90.0A0A0D3HCW9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0B9L30.0A0A0E0B9L3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0QY930.0A0A0E0QY93_ORYRU; Uncharacterized protein
TrEMBLI1QTV60.0I1QTV6_ORYGL; Uncharacterized protein
TrEMBLQ339D40.0Q339D4_ORYSJ; Chitin-inducible gibberellin-responsive protein 2, putative, expressed
STRINGLOC_Os10g22430.10.0(Oryza sativa Japonica Group)
STRINGORGLA10G0063900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein